Gene Bio Systems
Recombinant Haloquadratum walsbyi Putative cobalt transport protein CbiM(cbiM)
Recombinant Haloquadratum walsbyi Putative cobalt transport protein CbiM(cbiM)
SKU:CSB-CF619275HAAE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Haloquadratum walsbyi (strain DSM 16790)
Uniprot NO.:Q18J48
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIMEGFLPPRWAAAWTLAAAPIVVYGAKQTIDIIRQDARVKALVAIGIAFVFILSALKF PSVTGSTSHPTGTGLLVVLFGPAVTAFTATIVLLYQALLLAHGGITTLGANVVAMGIIGP TVGWTAYQIIRPYTSLERATFIAAVLTDWTTYLVTSLQLGAAFPAGDGLDAIIISALDFA AIFTLTQVPIGILEGILAAAVIGYLTRLGSETIESLEVAA
Protein Names:Recommended name: Putative cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM
Gene Names:Name:cbiM Ordered Locus Names:HQ1835A
Expression Region:1-220
Sequence Info:full length protein
