Gene Bio Systems
Recombinant Halobacterium salinarum Protein CrcB homolog 1(crcB1)
Recombinant Halobacterium salinarum Protein CrcB homolog 1(crcB1)
SKU:CSB-CF888117HTM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Uniprot NO.:Q9HNW2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTGAVAPPAVLVAAGGALGAVLRWRVVAATPTTEYPAGTLVVNVVGSFVLAALTFAAADA DTMLLFGTGACGAFTTFASFSVDVVALVDADRPVAAAGHALGNLLGAGLAVALAWLLVA
Protein Names:Recommended name: Protein CrcB homolog 1
Gene Names:Name:crcB1 Ordered Locus Names:VNG_1919H
Expression Region:1-119
Sequence Info:full length protein
