Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haloarcula marismortui UPF0290 protein rrnAC3084(rrnAC3084)

Recombinant Haloarcula marismortui UPF0290 protein rrnAC3084(rrnAC3084)

SKU:CSB-CF719581HTJ

Regular price €1.468,95 EUR
Regular price Sale price €1.468,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Uniprot NO.:Q5UY54

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METVDTVVWALWAMLPAYIPNNAAVLAGGGRPIDGGRTWGGRRVLGDGKTWRGTLIGTAA GTALALGLTQVTPSVSAALGTDLPTFSLRAGLGLAFGAMLGDIGASFLKRRTGRERGAAF PGLDQLDFVVGALLCAFVAAPSWFTETFTLPVLVVVVVATPVLHVVTNGIAYLLGLKNEP W

Protein Names:Recommended name: UPF0290 protein rrnAC3084

Gene Names:Ordered Locus Names:rrnAC3084

Expression Region:1-181

Sequence Info:full length protein

View full details