Gene Bio Systems
Recombinant Haemophilus influenzae UPF0208 membrane protein NTHI1376(NTHI1376)
Recombinant Haemophilus influenzae UPF0208 membrane protein NTHI1376(NTHI1376)
SKU:CSB-CF680907HAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain 86-028NP)
Uniprot NO.:Q4QL94
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFFSIFKQGQIYLNTWPQEAKLGIIFPENRIMKATSFAQKFMPFVAVFAILWQQIYAKN DLMAFSIAILTALFALLIPFQGLYWLGKRANSPLENQSAVWFYDICERLKQQNEPLPFVQ EKPTYQHLAEVLRKAQSKFERAFWQEI
Protein Names:Recommended name: UPF0208 membrane protein NTHI1376
Gene Names:Ordered Locus Names:NTHI1376
Expression Region:1-147
Sequence Info:full length protein
