Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Large-conductance mechanosensitive channel(mscL)

Recombinant Haemophilus influenzae Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF404085HSE

Regular price €1.258,95 EUR
Regular price Sale price €1.258,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain PittGG)

Uniprot NO.:A5UH89

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFIKEFREFAMRGNVVDMAIGVIIGSAFGKIVSSLVSDIFTPVLGILTGGIDFKDMKFV LAQAQGDVPAVTLNYGLFIQNVIDFIIIAFAIFMMIKVINKVRKPEEKKTAPKAETLLTE IRDLLKNK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:CGSHiGG_06210

Expression Region:1-128

Sequence Info:full length protein

View full details