Skip to product information
1 of 1

Gene Bio Systems

Recombinant Haemophilus influenzae Heme exporter protein B(ccmB)

Recombinant Haemophilus influenzae Heme exporter protein B(ccmB)

SKU:CSB-CF332463HTA

Regular price €1.500,95 EUR
Regular price Sale price €1.500,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:P45033

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIFLEIIKRELQIAMRKNAEILNPLWFFLLVITLFPLVIGPDPKLLSRIAPGIAWVAALL SALLSFERLFRDDFIDGSLEQLMLTAQPLPMTALAKVVAHWLLTGLPLILLSPIAALLLS LEVNIWWALVLTLLLGTPVLSCIGAIGVALTVGLRKGGVLLSLLVVPLFIPVLIFASSVL EAAGLNVPYGGQLAILGAMMVGAVTLSPFAIAAALRISLDN

Protein Names:Recommended name: Heme exporter protein B Alternative name(s): Cytochrome c-type biogenesis protein CcmB

Gene Names:Name:ccmB Ordered Locus Names:HI_1090

Expression Region:1-221

Sequence Info:full length protein

View full details