Skip to product information
1 of 1

Gene Bio Systems

Recombinant Guinea pig 5-hydroxytryptamine receptor 2B(HTR2B)

Recombinant Guinea pig 5-hydroxytryptamine receptor 2B(HTR2B)

SKU:CSB-CF010888GU

Regular price €1.374,95 EUR
Regular price Sale price €1.374,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cavia porcellus (Guinea pig)

Uniprot NO.:P97267

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CNQSTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYKATKSVKTVRKCS NKIYFRNPMTENSKFFMKHGMRNGINSTMYQSPVRL

Protein Names:Recommended name: 5-hydroxytryptamine receptor 2B Short name= 5-HT-2B Short name= 5-HT2B Alternative name(s): Serotonin receptor 2B

Gene Names:Name:HTR2B

Expression Region:1-96

Sequence Info:full length protein

View full details