Skip to product information
1 of 1

Gene Bio Systems

Recombinant Grosmannia clavigera Signal peptidase complex catalytic subunit SEC11(SEC11)

Recombinant Grosmannia clavigera Signal peptidase complex catalytic subunit SEC11(SEC11)

SKU:CSB-CF516799GHF

Regular price €1.455,95 EUR
Regular price Sale price €1.455,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus) (Graphiocladiella clavigera)

Uniprot NO.:F0XJH4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSAVAKPRQLASQILNFGLILSTAFMIWKGLSVVSDSSSPIVVVLSGSMEPAFQRGDLL FLWNRNLLQETDVGEIVVYNVRGKDIPIVHRIVRKFGTGPHAKLLTKGDNNAGDDTDLYA QGQDYLERKDIVGSVVGYVPFVGYVTILLTEHPWLKKVMLGLMGVLVVLQRE

Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I

Gene Names:Name:SEC11 ORF Names:CMQ_2301

Expression Region:1-172

Sequence Info:full length protein

View full details