Gene Bio Systems
Recombinant Gracilaria tenuistipitata var. liui Photosystem I reaction center subunit III(psaF)
Recombinant Gracilaria tenuistipitata var. liui Photosystem I reaction center subunit III(psaF)
SKU:CSB-CF738176GBAK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gracilaria tenuistipitata var. liui (Red alga)
Uniprot NO.:Q6B948
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EVETAGLTKCQESPAFTKRLNNSVKKLETRLAKYDANTPPAIALQTQIIKTKIRFNKYAK SGILCGTDGLPHLITDGRWNHAGEFMIPGVLFLYITGWIGWVGRGYLRDISQTTKPTEKE IILDVPLALKYCLSGFTWPLAAIKELTSGELVADNKDIPISPR
Protein Names:Recommended name: Photosystem I reaction center subunit III Alternative name(s): PSI-F
Gene Names:Name:psaF Ordered Locus Names:Grc000005
Expression Region:25-187
Sequence Info:full length protein
