Gene Bio Systems
Recombinant Gorilla gorilla gorilla Galactoside 2-alpha-L-fucosyltransferase 2(FUT2)
Recombinant Gorilla gorilla gorilla Galactoside 2-alpha-L-fucosyltransferase 2(FUT2)
SKU:CSB-CF009076GGZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Gorilla gorilla gorilla (Lowland gorilla)
Uniprot NO.:O77486
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSQPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSPIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
Protein Names:Recommended name: Galactoside 2-alpha-L-fucosyltransferase 2 EC= 2.4.1.69 Alternative name(s): Alpha(1,2)FT 2 Fucosyltransferase 2 GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
Gene Names:Name:FUT2
Expression Region:1-343
Sequence Info:full length protein
