Gene Bio Systems
Recombinant Glycine max Stress-induced protein SAM22
Recombinant Glycine max Stress-induced protein SAM22
SKU:CSB-YP333215GGV
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P26987
Gene Names: N/A
Organism: Glycine max (Soybean) (Glycine hispida)
AA Sequence: MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
Expression Region: 1-158aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 18.8 kDa
Alternative Name(s):
Relevance:
Reference: Characterization of a stress-induced, developmentally regulated gene family from soybean.Crowell D., John M.E., Russell D., Amasino R.M.Plant Mol. Biol. 18:459-466(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
