
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Georychus capensis (Cape mole rat)
Uniprot NO.:P50689
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAYPHQLGFQDATSPIMEELLSFHDHTLMIVFLISSLVLYLISLMLTTKLTHTSTMDAQE VETVWTILPAIILIMIALPSLRILYMMDEINNPLLTVKTMGHQWYWTYEYTDYEELNFDS YMVPTTDLNPGELRLLEVDNRVVLPMETPIRMLISSEDVLHSWTVPSMGLKTDAIPGRLN QATLTSSRPGLFYGQCSEICGSNHSFMPIVIEMVPLKSFENWTTSMT
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:MT-CO2 Synonyms:COII, COXII, MTCO2
Expression Region:1-227
Sequence Info:full length protein
You may also like
-
Recombinant Syncerus caffer Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.109,95 EUR
- Sale price
- €1.109,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cat Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.109,95 EUR
- Sale price
- €1.109,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cavia aperea Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.109,95 EUR
- Sale price
- €1.109,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Boselaphus tragocamelus Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- €1.109,95 EUR
- Sale price
- €1.109,95 EUR
- Regular price
-
- Unit price
- per
Sold out