Recombinant Geobacter sulfurreducens  ATP synthase subunit b(atpF)

Recombinant Geobacter sulfurreducens ATP synthase subunit b(atpF)

CSB-CF751648GBK
Regular price
€1.077,95 EUR
Sale price
€1.077,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

Uniprot NO.:Q74GY4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAYAFKKNGLLKPFVSTAAICLLVAGTVVLCHASGGGEGAHHVDTGKQMKDFMWRVIDFI ALAGVIVWALKKANAKGALADRSANVEKALREAEEARTAAEKKFAEYSEKLEKANQEIDG IYAAIRKEGELEKERIIAEARITAEKIREQATATATQEVLKARAELRDEAARLAVQMAEQ ALREAIKKDDQDRLVSEYLTKVENLH

Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b

Gene Names:Name:atpF Ordered Locus Names:GSU0109

Expression Region:1-206

Sequence Info:full length protein

Your list is ready to share