Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacter lovleyi ATP synthase subunit a(atpB)

Recombinant Geobacter lovleyi ATP synthase subunit a(atpB)

SKU:CSB-CF015070GFO

Regular price €1.506,95 EUR
Regular price Sale price €1.506,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)

Uniprot NO.:B3E9X3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVHPLLFLQFLSTKLQHLLHISDASANAVVYTWTVIVLLLVLSLIATRALKTIPSGVQNF MEVVVDGIENMIVETMGEHGRSFFPLIATLAIFILVSNLVGLIPGFYPPTANVNTTAACA IVVFLATHVVGIKHHGFHYLKHFMGPIWWLAPLMFFIEVIGHLSRPVSLTLRLFGNMNGH ELVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEAH

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6

Gene Names:Name:atpB Ordered Locus Names:Glov_3142

Expression Region:1-230

Sequence Info:full length protein

View full details