Gene Bio Systems
Recombinant Geobacillus stearothermophilus Protein translocase subunit SecY(secY)
Recombinant Geobacillus stearothermophilus Protein translocase subunit SecY(secY)
SKU:CSB-CF328822GFM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacillus stearothermophilus (Bacillus stearothermophilus)
Uniprot NO.:P28620
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:NPEQMAENLKKQGGYIPGIRPGKNTQEYVTRILYRLTLVGSVFLAVIAVLPVFFVNVANL PPSAKIGGTSLLIVVGVALETMKQLESQLVKRHYRGFIK
Protein Names:Recommended name: Protein translocase subunit SecY
Gene Names:Name:secY
Expression Region:1-99
Sequence Info:full length protein
