Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacillus stearothermophilus Potassium-transporting ATPase A chain(kdpA)

Recombinant Geobacillus stearothermophilus Potassium-transporting ATPase A chain(kdpA)

SKU:CSB-CF310547GFM

Regular price €1.244,95 EUR
Regular price Sale price €1.244,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacillus stearothermophilus (Bacillus stearothermophilus)

Uniprot NO.:P94456

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFRNIHYFLLLIVIAVPLGKYLYVAFFEKGKIDRFFSPIEAVIYRLSGIRSLEEMTWKS YCTALLIVNAALLGISYGLLRIQHYLPLNGAKVENMEPTLTFNTVVSFMTNTNLQ

Protein Names:Recommended name: Potassium-transporting ATPase A chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] A chain Potassium-binding and translocating subunit A Potassium-translocating ATPase A chain

Gene Names:Name:kdpA

Expression Region:1-115

Sequence Info:full length protein

View full details