Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacillus sp. UPF0344 protein GWCH70_0687 (GWCH70_0687)

Recombinant Geobacillus sp. UPF0344 protein GWCH70_0687 (GWCH70_0687)

SKU:CSB-CF511752GFJ

Regular price €1.435,95 EUR
Regular price Sale price €1.435,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacillus sp. (strain WCH70)

Uniprot NO.:C5D6R3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTHAHITSWLITVILFFIAVSLQRSGASKAKIVQMALRLFYIFTVITGGLLLHSIASISI LYIIKAIVGLWLIGAMEMVLSGMKKGKNTNVAWIQWIVAFVLVLFLGFMLPLGFDLF

Protein Names:Recommended name: UPF0344 protein GWCH70_0687

Gene Names:Ordered Locus Names:GWCH70_0687

Expression Region:1-117

Sequence Info:full length protein

View full details