Skip to product information
1 of 1

Gene Bio Systems

Recombinant Fowlpox virus Protein FPV129 (FPV129)

Recombinant Fowlpox virus Protein FPV129 (FPV129)

SKU:CSB-CF323395FEY

Regular price €1.377,95 EUR
Regular price Sale price €1.377,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Fowlpox virus (strain NVSL) (FPV)

Uniprot NO.:P15911

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHTFLTARLQAIEDVSNRNLSMLELILTRAIVTHWIILDLVLNLIFDSLITSFVIIYSLY SFVARNNKVLLFLLMSYAIFRFIVMYLLYIVSESID

Protein Names:Recommended name: Protein FPV129

Gene Names:Ordered Locus Names:FPV129 ORF Names:FP3

Expression Region:1-96

Sequence Info:full length protein

View full details