Gene Bio Systems
Recombinant Fowl adenovirus A serotype 1 Uncharacterized protein ORF21(21)
Recombinant Fowl adenovirus A serotype 1 Uncharacterized protein ORF21(21)
SKU:CSB-CF731082FCL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Fowl adenovirus A serotype 1 (strain CELO / Phelps) (FAdV-1) (Avian adenovirus gal1 (strain Phelps))
Uniprot NO.:Q64764
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MCTGSTGSLIPSVSDSANSVRRGNLSLCSVLLSWLICAMCLWNDARESLVNVRIANYVFD FAVLWTLLARVLGPPGRPVLQQHHPVQLPVPTEPSVFVKLCNQRVRL
Protein Names:Recommended name: Uncharacterized protein ORF21
Gene Names:ORF Names:21
Expression Region:1-107
Sequence Info:full length protein
