Gene Bio Systems
Recombinant Faba bean necrotic yellows virus Putative movement protein(DNA-M)
Recombinant Faba bean necrotic yellows virus Putative movement protein(DNA-M)
SKU:CSB-CF893867FDZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Faba bean necrotic yellows virus (isolate Egyptian EV1-93) (FBNYV)
Uniprot NO.:Q9WIJ7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADTGYYAGYQDDVDVDEQKRHQALYLIGIILLVTVCLTVLWVCIMLACYVPGFLKKTLE AWLNSSSLMKRRVASTLTRTPFEATGPERERNWEARRQSTTVNPASQPNTGSVF
Protein Names:Recommended name: Putative movement protein Short name= MP
Gene Names:Name:DNA-M Synonyms:C4
Expression Region:1-114
Sequence Info:full length protein
