Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli UPF0716 protein fxsA(fxsA)

Recombinant Escherichia coli UPF0716 protein fxsA(fxsA)

SKU:CSB-CF330681ENV

Regular price €1.440,95 EUR
Regular price Sale price €1.440,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P37147

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQ KMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSR MPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQD

Protein Names:Recommended name: UPF0716 protein fxsA Alternative name(s): Suppressor of F exclusion of phage T7

Gene Names:Name:fxsA Synonyms:yjeG Ordered Locus Names:b4140, JW4100

Expression Region:1-158

Sequence Info:full length protein

View full details