Recombinant Escherichia coli  UPF0382 inner membrane protein ygdD(ygdD)

Recombinant Escherichia coli UPF0382 inner membrane protein ygdD(ygdD)

CSB-CF359991ENV
Regular price
€1.019,95 EUR
Sale price
€1.019,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0ADR2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA MQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVTPVGGVSFLAGWALMLVGA IRLKRKGVSHE

Protein Names:Recommended name: UPF0382 inner membrane protein ygdD

Gene Names:Name:ygdD Ordered Locus Names:b2807, JW2778

Expression Region:1-131

Sequence Info:full length protein

Your list is ready to share