Gene Bio Systems
Recombinant Escherichia coli Uncharacterized protein ymfR(ymfR)
Recombinant Escherichia coli Uncharacterized protein ymfR(ymfR)
SKU:CSB-CF305136ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P75979
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK
Protein Names:Recommended name: Uncharacterized protein ymfR
Gene Names:Name:ymfR Ordered Locus Names:b1150, JW1136
Expression Region:1-60
Sequence Info:full length protein
