Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Uncharacterized protein yjeT(yjeT)

Recombinant Escherichia coli Uncharacterized protein yjeT(yjeT)

SKU:CSB-CF360230ENV

Regular price €1.347,95 EUR
Regular price Sale price €1.347,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0AF73

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Protein Names:Recommended name: Uncharacterized protein yjeT

Gene Names:Name:yjeT Ordered Locus Names:b4176, JW4134

Expression Region:1-65

Sequence Info:full length protein

View full details