Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Type 4 prepilin-like proteins leader peptide-processing enzyme(gspO)

Recombinant Escherichia coli Type 4 prepilin-like proteins leader peptide-processing enzyme(gspO)

SKU:CSB-CF338709ENV

Regular price €1.503,95 EUR
Regular price Sale price €1.503,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P25960

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTMLLPLFILVGFIADYFVNAIAYHLSPLEDKTALTFRQVLVHFRQKKYAWHDTVPLILC VAAAIACALAPFTPIVTGALFLYFCFVLTLSVIDFRTQLLPDKLTLPLLWLGLVFNAQYG LIDLHDAVYGAVAGYGVLWCVYWGVWLVCHKEGLGYGDFKLLAAAGAWCGWQTLPMILLI ASLGGIGYAIVSQLLQRRTITTIAFGPWLALGSMINLGYLAWISY

Protein Names:Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name(s): Prepilin peptidase N-methyltransferase EC= 2.1.1.-

Gene Names:Name:gspO Synonyms:hofD, hopD, hopO, yheC Ordered Locus Names:b3335, JW3297

Expression Region:1-225

Sequence Info:full length protein

View full details