Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)

Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)

SKU:CSB-EP361210ENV

Regular price €1.023,95 EUR
Regular price Sale price €1.023,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P04128

Gene Names: fimA

Organism: Escherichia coli (strain K12)

AA Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Expression Region: 24-182aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 31.8 kDa

Alternative Name(s): Type-1A pilin

Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs

Reference: "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes."Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details