Recombinant Escherichia coli Plasmid-derived single-stranded DNA-binding protein(ssbF)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli Plasmid-derived single-stranded DNA-binding protein(ssbF)

CSB-EP323579ENV
Regular price
€917,95 EUR
Sale price
€917,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P18310

Gene Names: ssbF

Organism: Escherichia coli (strain K12)

AA Sequence: AVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGECLRKGAQVYIEGQLRTRSWEDNGITRYVTEILVKTTGTMQMLVRAAGAQTQPEEGQQFSGQPQPEPQAEAGTKKGGAKTKGRGRKAAQPEPQPQPPEGDDYGFSDDIPF

Expression Region: 2-179aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 35.5 kDa

Alternative Name(s): Helix-destabilizing protein

Relevance: May contribute to the conjugative processing of DNA. It has a functional relationship with Psi (plasmid-mediated sos inhibition) proteins.

Reference: F sex factor encodes a single-stranded DNA binding protein (SSB) with extensive sequence homology to Escherichia coli SSB.Chase J.W., Merrill B.M., Williams K.R.Proc. Natl. Acad. Sci. U.S.A. 80:5480-5484(1983)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Escherichia coli CS6 fimbrial subunit B(cssB)
    Regular price
    €917,95 EUR
    Sale price
    €917,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Type-1 fimbrial protein, A chain(fimA)
    Regular price
    €917,95 EUR
    Sale price
    €917,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli 30S ribosomal protein S2(rpsB)
    Regular price
    €917,95 EUR
    Sale price
    €917,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Recombination protein RecR(recR)
    Regular price
    €917,95 EUR
    Sale price
    €917,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share