Recombinant Escherichia coli O8  Fumarate reductase subunit D(frdD)

Recombinant Escherichia coli O8 Fumarate reductase subunit D(frdD)

CSB-CF487712EOO
Regular price
€1.010,95 EUR
Sale price
€1.010,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O8 (strain IAI1)

Uniprot NO.:B7M8R6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGIVTI

Protein Names:Recommended name: Fumarate reductase subunit D Alternative name(s): Fumarate reductase 13 kDa hydrophobic protein

Gene Names:Name:frdD Ordered Locus Names:ECIAI1_4388

Expression Region:1-119

Sequence Info:full length protein

Your list is ready to share