GeneBio Systems
Recombinant Escherichia coli O157:H7 Major curlin subunit (csgA), partial
Recombinant Escherichia coli O157:H7 Major curlin subunit (csgA), partial
SKU:Q93U24
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q93U24
Gene Names: csgA
Alternative Name(s):
Abbreviation: Recombinant E.coli O157: H7 csgA protein, partial
Organism: Escherichia coli O157: H7
Source: E.coli
Expression Region: 64-113aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: ARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSH
MW: 18.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin.
Reference: "Mutations in the csgD promoter associated with variations in curli expression in certain strains of Escherichia coli O157: H7." Uhlich G.A., Keen J.E., Elder R.O. Appl. Environ. Microbiol. 67: 2367-2370(2001)
Function:
