Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O139:H28 Leucine efflux protein(leuE)

Recombinant Escherichia coli O139:H28 Leucine efflux protein(leuE)

SKU:CSB-CF419915EJD

Regular price €1.490,95 EUR
Regular price Sale price €1.490,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O139:H28 (strain E24377A / ETEC)

Uniprot NO.:A7ZMR9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFL AWAGVATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNNEAKSDEPQYGAIFKRA LILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQ YIRTKKKLAKVGNSLIGLMFVGFAARLATLQS

Protein Names:Recommended name: Leucine efflux protein

Gene Names:Name:leuE Ordered Locus Names:EcE24377A_2024

Expression Region:1-212

Sequence Info:full length protein

View full details