Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Nickel-responsive regulator(nikR)

Recombinant Escherichia coli Nickel-responsive regulator(nikR)

SKU:CSB-EP363929ENV

Regular price €911,95 EUR
Regular price Sale price €911,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0A6Z6

Gene Names: nikR

Organism: Escherichia coli (strain K12)

AA Sequence: MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED

Expression Region: 1-133aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 19.1 kDa

Alternative Name(s):

Relevance: Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel.

Reference: Crystal structure of the nickel-responsive transcription factor NikR.Schreiter E.R., Sintchak M.D., Guo Y., Chivers P.T., Sauer R.T., Drennan C.L.Nat. Struct. Biol. 10:794-799(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details