Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Inner membrane protein yjdF(yjdF)

Recombinant Escherichia coli Inner membrane protein yjdF(yjdF)

SKU:CSB-CF331000ENV

Regular price €1.492,95 EUR
Regular price Sale price €1.492,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P39270

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTRTLKPLILNTSALTLTLILIYTGISAHDKLTWLMEVTPVIIVVQLLLATARRYPLTPL LYTLIFLHAIILMVGGQYTYAKVPVGFEVQEWLGLSRNPYDKLGHFFQGLVPALVAREIL VRGMYVRGRKMVAFLVCCVALAISAMYELIEWWAALAMGQGADDFLGTQGDQWDTQSDMF CALLGALTTVIFLARFHCRQLRRFGLITG

Protein Names:Recommended name: Inner membrane protein yjdF

Gene Names:Name:yjdF Ordered Locus Names:b4121, JW4082

Expression Region:1-209

Sequence Info:full length protein

View full details