Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Histidine transport system permease protein hisM(hisM)

Recombinant Escherichia coli Histidine transport system permease protein hisM(hisM)

SKU:CSB-CF365199ENV

Regular price €1.524,95 EUR
Regular price Sale price €1.524,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0AEU3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIEILHEYWKPLLWTDGYRFTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIW LFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEI FAGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTA TVPDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQHVKPSSTH

Protein Names:Recommended name: Histidine transport system permease protein hisM

Gene Names:Name:hisM Ordered Locus Names:b2307, JW2304

Expression Region:1-238

Sequence Info:full length protein

View full details