Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)

Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)

CSB-EP356922ENLa3
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: eltA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli

Delivery time: 3-7 business days

Uniprot ID: P06717

AA Sequence: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL

Tag info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 19-258aa

Protein length: Full Length of Mature Protein

MW: 45.3 kDa

Alternative Name(s): LT-A, porcine LTP-A

Relevance: The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Reference: "Evolutionary origin of pathogenic determinants in enterotoxigenic Escherichia coli and Vibrio cholerae O1." Yamamoto T., Gojobori T., Yokota T. J. Bacteriol. 169:1352-1357(1987)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share