Gene Bio Systems
Recombinant Escherichia coli FKBP-type peptidyl-prolyl cis-trans isomerase fkpA(fkpA)
Recombinant Escherichia coli FKBP-type peptidyl-prolyl cis-trans isomerase fkpA(fkpA)
SKU:CSB-EP338214ENV
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P45523
Gene Names:fkpA
Organism:Escherichia coli (strain K12)
AA Sequence:AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
Expression Region:26-270aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:33.2 kDa
Alternative Name(s):Rotamase yzzS
Relevance:PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Reference:"Escherichia coli and other species of the Enterobacteriaceae encode a protein similar to the family of Mip-like FK506-binding proteins." Horne S.M., Young K.D. Arch. Microbiol. 163:357-365(1995)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Involvement in disease:
Subcellular Location:Periplasm
Protein Families:FKBP-type PPIase family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ecj:JW3309
STRING Database Link:https://string-db.org/network/316385.ECDH10B_3522
OMIM Database Link:
Lead Time Guidance:3-7 business days
