Recombinant Escherichia coli Elongation factor P(efp)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli Elongation factor P(efp)

CSB-EP358853ENV
Regular price
€753,95 EUR
Sale price
€753,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0A6N4

Gene Names: efp

Organism: Escherichia coli (strain K12)

AA Sequence: ATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

Expression Region: 2-188aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 36.5 kDa

Alternative Name(s): Short name:EF-P

Relevance: Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Beta-lysylation at Lys-34 is required for alleviation. The Pro codons and their context do not affect activity; only consecutive Pro residues (not another amino acid) are affected by EF-P. Has stimulatory effects on peptide bond formation between ribosome-bound initiator tRNA(fMet) and puromycin, and N-acetyl-Phe tRNA(Phe)-primed poly(U)-directed poly(Phe) synthesis.

Reference: "Cloning, sequencing and overexpression of the gene for prokaryotic factor EF-P involved in peptide bond synthesis."Aoki H., Adams S.-L., Chung D.-G., Yaguchi M., Chuang S.-E., Ganoza M.C.Nucleic Acids Res. 19:6215-6220(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Escherichia coli Elongation factor P(efp)
    Regular price
    €826,95 EUR
    Sale price
    €826,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Elongation factor P(efp)
    Regular price
    €826,95 EUR
    Sale price
    €826,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Transcription termination factor Rho(rho)
    Regular price
    €753,95 EUR
    Sale price
    €753,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli RNA polymerase sigma factor rpoS(rpoS)
    Regular price
    €740,95 EUR
    Sale price
    €740,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share