Recombinant Escherichia coli  Cytochrome o ubiquinol oxidase subunit 3(cyoC)

Recombinant Escherichia coli Cytochrome o ubiquinol oxidase subunit 3(cyoC)

CSB-CF364658ENV
Regular price
€1.073,95 EUR
Sale price
€1.073,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0ABJ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTG KDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEF HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL SLFWHFLDVVWICVFTVVYLMGAM

Protein Names:Recommended name: Cytochrome o ubiquinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Cytochrome o ubiquinol oxidase subunit III Ubiquinol oxidase chain C

Gene Names:Name:cyoC Ordered Locus Names:b0430, JW0420

Expression Region:1-204

Sequence Info:full length protein

Your list is ready to share