Gene Bio Systems
Recombinant Erwinia carotovora subsp. atroseptica Protein psiE homolog(psiE)
Recombinant Erwinia carotovora subsp. atroseptica Protein psiE homolog(psiE)
SKU:CSB-CF728429EAAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)
Uniprot NO.:Q6D2A1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGSARSAMAAKALQTILNIGLLALATILVIFLVKETFHLAKVLLISSEKDSSYQLIEGI VIYFLYFEFIALIVKYFQSGYHFPLRYFIYIGITAIIRLIIVDHKSPSDTLVYSAAILLL VVTLYLANSNRLKRE
Protein Names:Recommended name: Protein psiE homolog
Gene Names:Name:psiE Ordered Locus Names:ECA3195
Expression Region:1-135
Sequence Info:full length protein
