Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine herpesvirus 4 Envelope protein US9 homolog (76)

Recombinant Equine herpesvirus 4 Envelope protein US9 homolog (76)

SKU:CSB-CF321598EFR

Regular price €1.493,95 EUR
Regular price Sale price €1.493,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)

Uniprot NO.:P18348

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGEPEPVVALTEDAPLSVYNPNYRSDNALIADGDSSPIGGDCCPAEAVAAAEEVATAALA SEEIYEMHIKSCISSTTCGDHNNSIGVTSGLTVRAAECHPPSPEAVGIEDVVVVQTAATT NGPSDTVPASAAASVISDDNGCVPLLGSRLELENYDLESGCYYSESDNETASLFIQRVGR RQARRHRRRRVALTVAGVVLVAVLCAISGIVGAFLARVFQ

Protein Names:Recommended name: Envelope protein US9 homolog Alternative name(s): Envelope protein 76 ORF76 protein

Gene Names:Ordered Locus Names:76

Expression Region:1-220

Sequence Info:full length protein

View full details