Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine arteritis virus Glycoprotein 2b(GP2b)

Recombinant Equine arteritis virus Glycoprotein 2b(GP2b)

SKU:CSB-CF335426EFH

Regular price €1.481,95 EUR
Regular price Sale price €1.481,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine arteritis virus (strain Bucyrus) (EAV)

Uniprot NO.:P28992

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AWWRGVHEVRVTDLFKDLQCDNLRAKDAFPSLGYALSIGQSRLSYMLQDWLLAAHRKEVM PSNIMPMPGLTPDCFDHLESSSYAPFINAYRQAILSQYPQELQLEAINCKLLAVVAPALY HNYHLANLTGPATWVVPTVGQLHYYASSSIFASSVEVLAAIILLFACIPLVTRVYISFTR LMSPSRRTSSGTLPRRKIL

Protein Names:Recommended name: Glycoprotein 2b Short name= Protein GP2b Alternative name(s): GP(S)

Gene Names:Name:GP2b ORF Names:2b

Expression Region:29-227

Sequence Info:full length protein

View full details