Gene Bio Systems
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1)
Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1)
SKU:CSB-CF355987EFA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Uniprot NO.:P03230
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNG PHDPLPHSPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHGGGDPHLPT LLLGSSGSGGDDDDPHGPVQLSYYD
Protein Names:Recommended name: Latent membrane protein 1 Short name= LMP-1 Alternative name(s): Protein p63 Cleaved into the following chain: 1. Protein p25
Gene Names:Name:LMP1 ORF Names:BNLF1
Expression Region:242-386
Sequence Info:full length protein
