Skip to product information
1 of 1

Gene Bio Systems

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2(EBNA2),partial

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2(EBNA2),partial

SKU:CSB-YP718162EEZ(A4)

Regular price €1.122,95 EUR
Regular price Sale price €1.122,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: EBNA2

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Delivery time: 3-7 business days

Uniprot ID: Q69022

AA Sequence: SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ

Tag info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

Expression Region: 247-454aa

Protein length: Partial

MW: 25.9 kDa

Alternative Name(s):

Relevance: Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).

Reference: "U2 region of Epstein-Barr virus DNA may encode Epstein-Barr nuclear antigen 2."Dambaugh T., Hennessy K., Chamnankit L., Kieff E.Proc. Natl. Acad. Sci. U.S.A. 81:7632-7636(1984)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details