Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase(PPDK),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase(PPDK),partial

CSB-EP336270EKM
Regular price
€920,95 EUR
Sale price
€920,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: PPDK

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Entamoeba histolytica

Delivery time: 3-7 business days

Uniprot ID: P37213

AA Sequence: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-342aa

Protein length: Partial

MW: 54.4 kDa

Alternative Name(s): Pyruvate, orthophosphate dikinase

Relevance: Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.

Reference: Primary structure of the pyruvate phosphate dikinase in Entamoeba histolytica.Bruchhaus I., Tannich E.Mol. Biochem. Parasitol. 62:153-156(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Pyruvate, phosphate dikinase(PPDK) ,partial
    Regular price
    €920,95 EUR
    Sale price
    €920,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Saccharomyces cerevisiae Exopolyphosphatase(PPX1)
    Regular price
    €920,95 EUR
    Sale price
    €920,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Saccharomyces cerevisiae Exopolyphosphatase(PPX1)
    Regular price
    €1.010,95 EUR
    Sale price
    €1.010,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase(LHPP)
    Regular price
    €612,95 EUR
    Sale price
    €612,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share