Skip to product information
1 of 1

Gene Bio Systems

Recombinant Emericella nidulans Mitochondrial intermembrane space import and assembly protein 40(mia40)

Recombinant Emericella nidulans Mitochondrial intermembrane space import and assembly protein 40(mia40)

SKU:CSB-CF005319EKF

Regular price €1.535,95 EUR
Regular price Sale price €1.535,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Uniprot NO.:P0C1D2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KPRSWKNTFIRVGLASGAVYYYNTSSVFAETPSLSFRPEAQPKHEDGKSLPTLDSIKPKS REEKKAPAAAADAAATPASTGANAQSESPLKSAEELEAEADQQAAFNPETGEINWDCPCL GGMAYGPCGEEFRAAFSCFVYSEEEPKGMDCIDKFKAMQDCFRAHPDVYGAELDDDEEAG AEANAAGVEQPLAAEVDASVPVEKHEQAKEVRDEVKSAAGEVAESEEVVPKALDVSEQEK TPEQQTEK

Protein Names:Recommended name: Mitochondrial intermembrane space import and assembly protein 40 Alternative name(s): Mitochondrial import inner membrane translocase TIM40

Gene Names:Name:mia40 Synonyms:tim40 ORF Names:AN11898

Expression Region:36-283

Sequence Info:full length protein

View full details