Skip to product information
1 of 1

Gene Bio Systems

Recombinant Emericella nidulans ATP synthase subunit 9, mitochondrial(atp9)

Recombinant Emericella nidulans ATP synthase subunit 9, mitochondrial(atp9)

SKU:CSB-CF323403EKF

Regular price €1.363,95 EUR
Regular price Sale price €1.363,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Uniprot NO.:P16000

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YSSEIADAMVQVSQNIGMGSAAIGLGGAGIGIGVVFGSLLLAVSRNPALRGQLFSYAILG FAFVEAIGLFDLMVAMMCKYV

Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein

Gene Names:Name:atp9 Synonyms:oliC ORF Names:AN1624

Expression Region:63-143

Sequence Info:full length protein

View full details