Skip to product information
1 of 1

Gene Bio Systems

Recombinant Elusimicrobium minutum UPF0059 membrane protein Emin_1326 (Emin_1326)

Recombinant Elusimicrobium minutum UPF0059 membrane protein Emin_1326 (Emin_1326)

SKU:CSB-CF452637EKE

Regular price €1.461,95 EUR
Regular price Sale price €1.461,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Elusimicrobium minutum (strain Pei191)

Uniprot NO.:B2KED0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIFTLLMIAAGLSMDNFAVSLASGCNPNIKIKDISKAALLFVAAHLVMFSLGWFGVSVI AERFDAYDHWISFGLLVFIGLRMIKEAAAKKGQQECVNITETFSRLLLIALATSMDALAV GISLSLAGVHFVLSVAAISFFVLITTFFGFKIGGKLGDKLGIKAEIFGGIVLIGIALKIL LDAMM

Protein Names:Recommended name: UPF0059 membrane protein Emin_1326

Gene Names:Ordered Locus Names:Emin_1326

Expression Region:1-185

Sequence Info:full length protein

View full details