Recombinant Elephas maximus Aquaporin-2(AQP2)

SKU: CSB-CF001962EKA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Elephas maximus (Indian elephant)

Uniprot NO.:P79168

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SIAFSRAVFSEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLAIGTLVQTLGHISGA HINPAVTVACLVGCHVSFLRATFYLAAQLLGAVAGAALLHELTPPDIRG

Protein Names:Recommended name: Aquaporin-2 Short name= AQP-2 Alternative name(s): ADH water channel Aquaporin-CD Short name= AQP-CD Collecting duct water channel protein WCH-CD Water channel protein for renal collecting duct

Gene Names:Name:AQP2

Expression Region:1-109

Sequence Info:full length protein