Skip to product information
1 of 1

Gene Bio Systems

Recombinant Elephantid herpesvirus 1 Glycoprotein N

Recombinant Elephantid herpesvirus 1 Glycoprotein N

SKU:CSB-CF619285EAAN

Regular price €1.458,95 EUR
Regular price Sale price €1.458,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) (EIHV-1) (Elephant endotheliotropic herpesvirus)

Uniprot NO.:Q18LF1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARINSNSGTAVLSRGAAVPAARRPASGTSASKISKLSSTGPPNAPWSKSLTIFKTFISV YLGQAACLAASSRISSRCIVCIRSTLFLTLFALNVAQEFVFGATPAPTVKTDLNIRDFSK SSCSALKYRIYVSSFVSVLNIILYVLLFLASVVYIRYLCHQSITTETVKDY

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:

Expression Region:1-171

Sequence Info:full length protein

View full details