Skip to product information
1 of 1

Gene Bio Systems

Recombinant Duck hepatitis B virus Large envelope protein(S)

Recombinant Duck hepatitis B virus Large envelope protein(S)

SKU:CSB-CF717826DCAE

Regular price €1.350,95 EUR
Regular price Sale price €1.350,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Duck hepatitis B virus (isolate Shanghai/DHBVQCA34) (DHBV)

Uniprot NO.:Q66405

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISQH YVGSCPWGCPGFLWTYL

Protein Names:Recommended name: Large envelope protein Alternative name(s): L glycoprotein L-HBsAg Short name= LHB Large S protein Large surface protein Major surface antigen Cleaved into the following chain: 1. Truncated S protein

Gene Names:Name:S

Expression Region:164-240

Sequence Info:full length protein

View full details