Gene Bio Systems
Recombinant Duck hepatitis B virus Large envelope protein(S)
Recombinant Duck hepatitis B virus Large envelope protein(S)
SKU:CSB-CF717826DCAE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Duck hepatitis B virus (isolate Shanghai/DHBVQCA34) (DHBV)
Uniprot NO.:Q66405
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPGTFGGILAGLIGLLVSFFLLIKILEILRRLDWWWISLSSPKGKMQCAFQDTGAQISQH YVGSCPWGCPGFLWTYL
Protein Names:Recommended name: Large envelope protein Alternative name(s): L glycoprotein L-HBsAg Short name= LHB Large S protein Large surface protein Major surface antigen Cleaved into the following chain: 1. Truncated S protein
Gene Names:Name:S
Expression Region:164-240
Sequence Info:full length protein
