Gene Bio Systems
Recombinant Drosophila simulans Vacuolar ATPase assembly integral membrane protein VMA21 (GD14890)
Recombinant Drosophila simulans Vacuolar ATPase assembly integral membrane protein VMA21 (GD14890)
SKU:CSB-CF025866DMJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila simulans (Fruit fly)
Uniprot NO.:B4QJ33
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:ORF Names:GD14890
Expression Region:1-105
Sequence Info:full length protein
